General Information

  • ID:  hor006775
  • Uniprot ID:  Q9ERG3
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  CGA
  • Organism:  Microtus montebelli (Japanese grass vole)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Microtus (genus), Arvicolinae (subfamily), Cricetidae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  LPDGDLIIQGCPECKLKENKYFSRLGNPVYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKTTVLGYARVENHTECHCSTCYYHKV
  • Length:  96(25-120)
  • Propeptide:  MDYYRKYAAVFLVMLSMFLHSLHSLPDGDLIIQGCPECKLKENKYFSRLGNPVYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKTTVLGYARVENHTECHCSTCYYHKV
  • Signal peptide:  MDYYRKYAAVFLVMLSMFLHSLHS
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-86; 36-88; 63-91
  • Structure ID:  AF-Q9ERG3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006775_AF2.pdbhor006775_ESM.pdb

Physical Information

Mass: 1247422 Formula: C469H741N129O138S12
Absent amino acids: W Common amino acids: CKT
pI: 8.56 Basic residues: 16
Polar residues: 40 Hydrophobic residues: 23
Hydrophobicity: -32.29 Boman Index: -14840
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 59.9
Instability Index: 5746.98 Extinction Coefficient cystines: 9565
Absorbance 280nm: 100.68

Literature

  • PubMed ID:  12112597
  • Title:  Comparison of glycoprotein hormone alpha-subunits of laboratory animals.